Anti-PLD3 antibody (ab223489)
Key features and details
- Rabbit polyclonal to PLD3
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PLD3 antibody -
Description
Rabbit polyclonal to PLD3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan -
Immunogen
Recombinant fragment corresponding to Human PLD3 aa 70-176.
Sequence:PNQRPAPCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSS LDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPS GPQPQAD
Database link: Q8IV08 -
Positive control
- IHC-P: Human brain tissue. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223489 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Tissue specificity
Widely expressed. Expressed at higher level in brain. Expressed at low level in corpus callosum, suggesting that it is highly expressed in neurons. -
Sequence similarities
Belongs to the phospholipase D family.
Contains 2 PLD phosphodiesterase domains. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 613932 Cow
- Entrez Gene: 101866889 Cynomolgus monkey
- Entrez Gene: 23646 Human
- Entrez Gene: 18807 Mouse
- Entrez Gene: 100173883 Orangutan
- Entrez Gene: 361527 Rat
- Omim: 615698 Human
- SwissProt: Q2KJJ8 Cow
see all -
Alternative names
- Choline phosphatase 3 antibody
- HindIII K4L homolog antibody
- HU K4 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLD3 antibody (ab223489)
Paraffin-embedded human brain tissue stained for PLD3 using ab223489 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PLD3 (green) using ab223489 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).
Protocols
References (0)
ab223489 has not yet been referenced specifically in any publications.