Anti-PLD3 antibody (ab76433)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PLD3 antibody
See all PLD3 primary antibodies -
Description
Rabbit polyclonal to PLD3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ELISAmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog -
Immunogen
Synthetic peptide corresponding to Human PLD3 aa 38-87 (N terminal).
Sequence:WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
-
Positive control
- Fetal heart lysate
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab76433 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Detects a band of approximately 55 kDa (predicted molecular weight: 55 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. | |
ELISA | Use at an assay dependent concentration. ELISA titre using peptide based assay 1:62500. |
Target
-
Tissue specificity
Widely expressed. Expressed at higher level in brain. Expressed at low level in corpus callosum, suggesting that it is highly expressed in neurons. -
Sequence similarities
Belongs to the phospholipase D family.
Contains 2 PLD phosphodiesterase domains. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 613932 Cow
- Entrez Gene: 23646 Human
- Entrez Gene: 18807 Mouse
- Entrez Gene: 361527 Rat
- Omim: 615698 Human
- SwissProt: Q2KJJ8 Cow
- SwissProt: Q8IV08 Human
- SwissProt: O35405 Mouse
see all -
Alternative names
- Choline phosphatase 3 antibody
- HindIII K4L homolog antibody
- HU K4 antibody
see all
Images
-
Western blot analysis of Human adult placenta tissue lysate labeling PLD3 with ab76433 at 1.0µg/ml.
-
Anti-PLD3 antibody (ab76433) at 1 µg/ml + fetal heart lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 55 kDa
Observed band size: 55 kDa
Gel concentration 12%
Protocols
Datasheets and documents
References
ab76433 has not yet been referenced specifically in any publications.