Overview

  • Product name

  • Description

    Rabbit polyclonal to PLD6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PLD6 aa 1-252.
    Sequence:

    MGRLSWQVAAAAAVGLALTLEALPWVLRWLRSRRRRPRREALFFPSQVTC TEALLRAPGAELAELPEGCPCGLPHGESALSRLLRALLAARASLDLCLFA FSSPQLGRAVQLLHQRGVRVRVVTDCDYMALNGSQIGLLRKAGIQVRHDQ DPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLE EFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSES QT


    Database link: Q8N2A8

  • Positive control

    • WB: Mouse kidney, brain and skeletal muscle lysates. IHC-P: Human testis tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Predicted molecular weight: 28 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Cardiolipin hydrolase present at the mitochondrial outer membrane required both for mitochondrial fusion and piRNA metabolic process. Acts by catalyzing the hydrolysis of cardiolipin (diphosphatidylglycerol) to form phosphatidate (phosphatidic acid or PA) at the mitochondrial outer membrane surface, promoting mitochondrial fusion. The production of phosphatidate also regulates the piRNA metabolic process by promoting recruitment and/or activation of components of the meiotic nuage, also named P granule, a critical step for primary biogenesis of piRNAs. Required during spermatogenesis to repress transposable elements and prevent their mobilization via its role in the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons.
  • Tissue specificity

    Widely expressed. Expression is not limites to testis and ovary.
  • Sequence similarities

    Belongs to the phospholipase D family. MitoPLD/Zucchini subfamily.
    Contains 1 PLD phosphodiesterase domain.
  • Domain

    In contrast to other members of the phospholipase D family, contains only one PLD phosphodiesterase domain, suggesting that it has a single half-catalytic and requires homodimerization to form a complete active site (PubMed:17028579).
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Choline phosphatase 6 antibody
    • Mitochondrial cardiolipin hydrolase antibody
    • Mitochondrial phospholipase antibody
    • MitoPLD antibody
    • Phosphatidylcholine hydrolyzing phospholipase D6 antibody
    • Phosphatidylcholine-hydrolyzing phospholipase D6 antibody
    • Phospholipase D family member 6 antibody
    • Phospholipase D6 antibody
    • PLD 6 antibody
    • pld6 antibody
    • PLD6_HUMAN antibody
    • Protein zucchini homolog antibody
    • ZUC antibody
    • Zucchini, Drosophila, homolog of antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for PLD6 using ab237612 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-PLD6 antibody (ab237612) at 1/2000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Mouse skeletal muscle lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PLD6 (green) using ab237612 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up