Overview

  • Product name
    Anti-PLEKHA6 antibody
  • Description
    Rabbit polyclonal to PLEKHA6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PLEKHA6 aa 390-481.
    Sequence:

    EDKRHAFRNGGGPAYQLREWKEPASYGRQDATVWIPSPSRQPVYYDELDA ASSSLRRLSLQPRSHSVPRSPSQGSYSRARIYSPVRSPSARF


    Database link: Q9Y2H5

  • Positive control
    • MCF7 cells.
  • General notes

     This product was previously labelled as PEPP3

     

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Trioton X-100 permeabilized MCF7 cells labeling PLEKHA6 with ab220702 at 4 µg/ml (green).

References

ab220702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up