Overview

  • Product name

  • Description

    Rabbit polyclonal to PLEKHA7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PLEKHA7 aa 287-381.
    Sequence:

    SSLKRDMEKVERQAVPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFE RQEQEGEQYRSQRDPLEGKRDRSKARSPYSPAEEDALFMDLPTGP


    Database link: Q6IQ23

  • Positive control

    • WB: PLEKHA7 overexpression HEK-293T cell lysate. IHC-P: Human stomach tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 127 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for zonula adherens biogenesis and maintenance. Acts via its interaction with KIAA1543/Nezha, which anchors microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.
  • Sequence similarities

    Contains 1 PH domain.
    Contains 2 WW domains.
  • Cellular localization

    Cell junction > adherens junction. Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Localizes to zonula adherens, recruited via its interaction with CTNND1.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686M22243 antibody
    • PH domain-containing family A member 7 antibody
    • PKHA7_HUMAN antibody
    • Pleckstrin homology domain containing family A member 2 antibody
    • Pleckstrin homology domain-containing family A member 7 antibody
    • Plekha7 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for PLEKHA7 (green) using ab224548 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-PLEKHA7 antibody (ab224548) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PLEKHA7 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 127 kDa

  • Paraffin-embedded human stomach tissue stained for PLEKHA7 with ab224548 at 1/200 dilution in immunohistochemical analysis.

References

ab224548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up