Overview

  • Product name

  • Description

    Rabbit polyclonal to PLEKHG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PLEKHG4 aa 1044-1134. Numbering is from isoform 1; the sequence also occurs in isoform 2.
    Sequence:

    MGVGNKAFRDIAPSEEAINDRTVNYVLKCREVRSRASIAVAPFDHDSLYL GASNSLPGDPASCSVLGSLNLHLYRDPALLGLRCPLYPSFP


    Database link: Q58EX7

  • Positive control

    • CACO-2 cells.
  • General notes

    Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Possible role in intracellular signaling and cytoskeleton dynamics at the Golgi.
  • Tissue specificity

    Expressed in kidney, Leydig cells in the testis, epithelial cells in the prostate gland and Langerhans islet in the pancreas. Isoform 1 and isoform 3 are strongly expressed in Purkinje cells and to a lower extent in other neurons (at protein level). Widely expressed at low levels. More strongly expressed in testis and pancreas.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGEF44 antibody
    • DKFZp434I216 antibody
    • PH domain containing family G member 4 antibody
    • PH domain-containing family G member 4 antibody
    • PKHG4_HUMAN antibody
    • Pleckstrin homology and RhoGEF domain containing G4 antibody
    • Pleckstrin homology domain containing family G (with RhoGef domain) member 4 antibody
    • Pleckstrin homology domain containing family G member 4 antibody
    • Pleckstrin homology domain-containing family G member 4 antibody
    • PLEKHG 4 antibody
    • PLEKHG4 antibody
    • PRTPHN 1 antibody
    • PRTPHN1 antibody
    • Puratrophin 1 antibody
    • Puratrophin-1 antibody
    • Puratrophin1 antibody
    • Purkinje cell atrophy associated protein 1 antibody
    • Purkinje cell atrophy-associated protein 1 antibody
    • SCA 4 antibody
    • SCA4 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized CACO-2 cells labeling PLEKHG4 with ab220770 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab220770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up