Overview

  • Product name

  • Description

    Rabbit polyclonal to PLEKHH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PLEKHH2 aa 304-373.
    Sequence:

    STLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYS WQQEAQWKALNSPLGKGNSE


    Database link: Q8IVE3

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223180 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Contains 1 FERM domain.
    Contains 1 MyTH4 domain.
    Contains 2 PH domains.
  • Cellular localization

    Membrane. Localizes to the slit diaphragm and foot process of podocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA2028 antibody
    • PKHH2_HUMAN antibody
    • Pleckstrin homology domain containing family H member 2 antibody
    • Pleckstrin homology domain-containing family H member 2 antibody
    • Pleckstrin homology MyTH4 and FERM domain containing H2 antibody
    • PLEKHH1L antibody
    • Plekhh2 antibody
    • PLEKHH2 pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PLEKHH2 (green) using ab223180 at 4 µg/ml in ICC/IF.

References

ab223180 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223180.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up