Overview

  • Product name

    Anti-PLEKHM1 antibody
  • Description

    Rabbit polyclonal to PLEKHM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PLEKHM1 aa 868-920.
    Sequence:

    PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHL IGR


    Database link: Q9Y4G2

  • Positive control

    • Human kidney tissue; U2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Involved in vesicular transport in the osteoclast (By similarity). May have a role in sialyl-lex-mediated transduction of apoptotic signals.
  • Tissue specificity

    Expressed in placenta, liver, prostate, thymus, spleen, ovary, colon, colon carcinoma and peripheral blood lymphocytes (PBL). Weakly expressed in brain, lung, kidney, and testis. No expression in heart, skeletal muscle, pancreas and small intestine. Predominantly expressed in the breast carcinoma cell line MCF-7.
  • Involvement in disease

    Defects in PLEKHM1 are the cause of osteopetrosis autosomal recessive type 6 (OPTB6) [MIM:611497]; also known as autosomal recessive osteopetrosis intermediate form. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts.
  • Sequence similarities

    Contains 2 PH domains.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 RUN domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 162 kDa adapter protein antibody
    • AP162 antibody
    • PH domain-containing family M member 1 antibody
    • PKHM1_HUMAN antibody
    • Pleckstrin homology domain-containing family M member 1 antibody
    • PLEKHM1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling PLEKHM1 with ab204437 at 1/20 dilution.

  • Immunofluorescent analysis of U2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling PLEKHM1 with ab204437 at 4 μg/ml (green).

References

ab204437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK293Tm HCT116)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
HEK293Tm HCT116
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Aug 28 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up