Overview

  • Product name

    Anti-Plexin A1 antibody [7B8H9]
    See all Plexin A1 primary antibodies
  • Description

    Mouse monoclonal [7B8H9] to Plexin A1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Plexin A1 aa 1100-1200. Expressed in E.coli.
    Sequence:

    TTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPD PVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTL T


    Database link: Q9UIW

  • Positive control

    • WB: Recombinant human Plexin A1 (AA: 1100-1200) and Plexin A1 (AA: 1100-1200)-hIgGFc transfected HEK-293 whole cell lysate. Flow: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Relevance

    Function: Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm. Tissue specificity: Detected in fetal brain, lung, liver and kidney. Similarity: Belongs to the plexin family. Contains 4 IPT/TIG domains. Contains 1 Sema domain.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • NOV antibody
    • NOV/plexin A1 protein antibody
    • NOVP antibody
    • Plexin-A1 antibody
    • Plexin1 antibody
    • PlexinA1 antibody
    • PLXA1_HUMAN antibody
    • PLXN1 antibody
    • Plxna1 antibody
    • PLXNA1 protein antibody
    • Semaphorin receptor NOV antibody
    see all

Images

  • Anti-Plexin A1 antibody [7B8H9] (ab233826) at 1/500 dilution + Recombinant human Plexin A1 (AA: 1100-1200) protein.

    Developed using the ECL technique.
  • All lanes : Anti-Plexin A1 antibody [7B8H9] (ab233826) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : Plexin A1 (AA: 1100-1200)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling Plexin A1 with ab233826 at 1/200 dilution (green) compared with a negative control (red).

References

ab233826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up