Overview

  • Product name

    Anti-Plexin B2/MM1 antibody
    See all Plexin B2/MM1 primary antibodies
  • Description

    Rabbit polyclonal to Plexin B2/MM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Plexin B2/ MM1 aa 1080-1200.
    Sequence:

    ALLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAE AFVGAERCTMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGS REWVLGRVEYDTRVSDVPLSL


    Database link: O15031

  • Positive control

    • WB: Mouse liver lysate. IHC-P: Human colon cancer and kidney tissues.
  • General notes

    Previously labelled as Plexin B2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab229950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 205 kDa (predicted molecular weight: 205 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Plexin B2/MM1 is a transmembrane receptor for the class 4 semaphorin, SEMA4D. This receptor has key roles in RHOA activation and subsequent changes of the actin cytoskeleton, axon guidance, invasive growth and cell migration.
  • Cellular localization

    Membrane; single-pass type I membrane protein.
  • Database links

  • Alternative names

    • KIAA0315 antibody
    • MM1 antibody
    • Plexin B2 antibody
    • PLXN B2 antibody
    • PLXNB2 antibody
    see all

Images

  • Anti-Plexin B2/MM1 antibody (ab229950) at 1/1000 dilution + Mouse liver lysate

    Secondary
    Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 205 kDa
    Observed band size: 205 kDa

  • Paraffin-embedded human colon cancer tissue stained for Plexin B2/MM1 using ab229950 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Plexin B2/MM1 using ab229950 at 1/100 dilution in immunohistochemical analysis.

References

ab229950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up