Overview

  • Product name

  • Description

    Rabbit polyclonal to PLGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PLGF aa 170-221 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVP RR


    Database link: P49763

  • Positive control

    • Human liver carcinoma and colon cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner.
  • Tissue specificity

    While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Domain

    Isoform PlGF-2 contains a basic insert which acts as a cell retention signal.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted. The three isoforms are secreted but PlGF-2 appears to remain cell attached unless released by heparin.
  • Information by UniProt
  • Database links

  • Alternative names

    • D12S1900 antibody
    • Pgf antibody
    • PGFL antibody
    • PIGF antibody
    • Placenta growth factor antibody
    • Placental growth factor antibody
    • Placental growth factor, vascular endothelial growth factor related protein antibody
    • PlGF 2 antibody
    • PlGF antibody
    • PLGF_HUMAN antibody
    • PlGF2 antibody
    • SHGC 10760 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human liver carcinoma tissue, labeling PLGF using ab217001 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon cancer tissue, labeling PLGF using ab217001 at a 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up