Anti-PLGF1 antibody (ab180734)
Key features and details
- Rabbit polyclonal to PLGF1
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-PLGF1 antibody -
Description
Rabbit polyclonal to PLGF1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human PLGF1 aa 19-170.
Sequence:LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWG CA
Database link: P49763 -
Positive control
- BT474 and Mouse brain cell extracts.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab180734 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
| WB | 1/500 - 1/2000. Predicted molecular weight: 25 kDa. |
Target
-
Relevance
Placental growth factor is found as three isoforms, PLGF1, PLGF2 and PLGF3 created by alternative splicing. They are secreted factors although PLGF2 remains attached to the cell unless releasd by heparin. PLGF1 is active in angiogenesis, and endothelial cell growth, stimulating proliferation and migration. It binds to receptor VEGFR-1/FLT1. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 5228 Human
- SwissProt: P49763 Human
-
Alternative names
- PGF antibody
- PGFL antibody
- Placenta growth factor antibody
- PlGF antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x. -
Western blot - Anti-PLGF1 antibody (ab180734)All lanes : Anti-PLGF1 antibody (ab180734) at 1/500 dilution
Lane 1 : BT474 cell extracts
Lane 2 : Mouse brain cell extracts
Predicted band size: 25 kDa
Protocols
Datasheets and documents
References (0)
ab180734 has not yet been referenced specifically in any publications.
