Anti-PLGF1 antibody (ab180734)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PLGF1 antibody -
Description
Rabbit polyclonal to PLGF1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human PLGF1 aa 19-170.
Sequence:LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWG CA
Database link: P49763 -
Positive control
- BT474 and Mouse brain cell extracts.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab180734 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB | 1/500 - 1/2000. Predicted molecular weight: 25 kDa. |
Target
-
Relevance
Placental growth factor is found as three isoforms, PLGF1, PLGF2 and PLGF3 created by alternative splicing. They are secreted factors although PLGF2 remains attached to the cell unless releasd by heparin. PLGF1 is active in angiogenesis, and endothelial cell growth, stimulating proliferation and migration. It binds to receptor VEGFR-1/FLT1. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 5228 Human
- SwissProt: P49763 Human
-
Alternative names
- PGF antibody
- PGFL antibody
- Placenta growth factor antibody
- PlGF antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLGF1 antibody (ab180734)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
-
All lanes : Anti-PLGF1 antibody (ab180734) at 1/500 dilution
Lane 1 : BT474 cell extracts
Lane 2 : Mouse brain cell extracts
Predicted band size: 25 kDa
Datasheets and documents
References
ab180734 has not yet been referenced specifically in any publications.