Overview

  • Product name

    Anti-PLGF1 antibody
  • Description

    Rabbit polyclonal to PLGF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PLGF1 aa 19-170.
    Sequence:

    LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWG CA


    Database link: P49763

  • Positive control

    • BT474 and Mouse brain cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab180734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 25 kDa.

Target

  • Relevance

    Placental growth factor is found as three isoforms, PLGF1, PLGF2 and PLGF3 created by alternative splicing. They are secreted factors although PLGF2 remains attached to the cell unless releasd by heparin. PLGF1 is active in angiogenesis, and endothelial cell growth, stimulating proliferation and migration. It binds to receptor VEGFR-1/FLT1.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • PGF antibody
    • PGFL antibody
    • Placenta growth factor antibody
    • PlGF antibody

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat kidney tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling PLGF1 with ab180734 at 1/200. Magnification: 400x.
  • All lanes : Anti-PLGF1 antibody (ab180734) at 1/500 dilution

    Lane 1 : BT474 cell extracts
    Lane 2 : Mouse brain cell extracts

    Predicted band size: 25 kDa

References

ab180734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up