Overview

  • Product name

    Anti-PLGLB1 antibody
  • Description

    Rabbit polyclonal to PLGLB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PLGLB1 aa 59-90.
    Sequence:

    FTCRAFQYHSKEQQCVIMAENRKSSIIIRMRD


    Database link: Q02325

  • Positive control

    • ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Function

    May bind noncovalently to lysine binding sites present in the kringle structures of plasminogen. This may interfere with the binding of fibrin or alpha-2-antiplasmin to plasminogen and may result in the localization of activity at sites necessary for extracellular matrix destruction.
  • Sequence similarities

    Contains 1 PAN domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Plasminogen-related protein B antibody
    • PLGB_HUMAN antibody
    • PLGLB2 antibody

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for PLGLB1 (green) using ab222379 at 4 µg/ml in ICC/IF.

References

ab222379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up