Anti-PLK3 antibody (ab230320)
Key features and details
- Rabbit polyclonal to PLK3
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PLK3 antibody
See all PLK3 primary antibodies -
Description
Rabbit polyclonal to PLK3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human PLK3 aa 487-646.
Sequence:VLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFA SYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNF YGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYA LRLLRDRSPA
Database link: Q9H4B4 -
Positive control
- IHC-P: Human testis tissue and colon cancer tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230320 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Serine/threonine protein kinase involved in regulating M phase functions during the cell cycle. May also be part of the signaling network controlling cellular adhesion. In vitro, is able to phosphorylate CDC25C and casein. -
Tissue specificity
Transcripts are highly detected in placenta, lung, followed by skeletal muscle, heart, pancreas, ovaries and kidney and weakly detected in liver and brain. May have a short half-live. In cells of hematopoietic origin, strongly and exclusively detected in terminally differentiated macrophages. Transcript expression appears to be down-regulated in primary lung tumor. -
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CDC5/Polo subfamily.
Contains 2 POLO box domains.
Contains 1 protein kinase domain. -
Post-translational
modificationsPhosphorylated as cells enter mitosis and dephosphorylated as cells exit mitosis. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 1263 Human
- Entrez Gene: 12795 Mouse
- Entrez Gene: 58936 Rat
- Omim: 602913 Human
- SwissProt: Q9H4B4 Human
- SwissProt: Q60806 Mouse
- SwissProt: Q9R011 Rat
- Unigene: 632415 Human
see all -
Alternative names
- CNK antibody
- Cytokine Inducible Kinase antibody
- Cytokine-inducible serine/threonine-protein kinase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLK3 antibody (ab230320)
Paraffin-embedded human testis tissue stained for PLK3 using ab230320 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PLK3 antibody (ab230320)Paraffin-embedded human colon cancer tissue stained for PLK3 using ab230320 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230320 has not yet been referenced specifically in any publications.
