Overview

  • Product name

  • Description

    Rabbit polyclonal to PLLP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human PLLP aa 1-35.
    Sequence:

    MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS


    Database link: Q9Y342

  • Positive control

    • WB: Mouse gonadal, kidney and lung tissue lysate. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as Plasmolipin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Plasmolipin is an 18 kDa membrane-bound proteolipid that belongs to the tetraspan (4TM) family, a rapidly growing group of myelin-associated proteins. Many of these proteins could be linked to human hereditary demyelinating neuropathies. Studies indicate that plasmolipin is a component of the cytoskeletal structure and has been localized to the apical surface of tubular epithelial cells. It has been shown that, upon addition to lipid bilayers, plasmolipin induces formation of ion channels that are both voltage-dependent and potassium-specific. Plasmolipin was originally isolated from kidney tissue. Subsequently, it has been shown to be widely expressed, not only being present in kidney, but also in the nervous system, thymus, testis, lung, and thyroid gland.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Plasma membrane proteolipid (plasmolipin) antibody
    • Plasmolipin antibody
    • PLLP antibody
    • PMLP antibody
    • TM4SF11 antibody
    • Transmembrane 4 superfamily member 11 (plasmolipin) antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling PLLP (green) using ab236668 at 1/100 dilution in ICC/IF. Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) was used as the secondary antibody.

  • All lanes : Anti-PLLP antibody (ab236668) at 1/1000 dilution

    Lane 1 : Mouse gonadal lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : Mouse lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

References

ab236668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up