Overview

  • Product name

  • Description

    Rabbit polyclonal to PLOD2/LH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human PLOD2/LH2 aa 468-517 (internal sequence). NP_891988
    Sequence:

    KGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQML

  • Positive control

    • DU145 cell lysate.
  • General notes

    Protein previously labeled as PLOD2.

Properties

Applications

Our Abpromise guarantee covers the use of ab90088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P 1/100.

Target

  • Function

    Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
  • Tissue specificity

    Highly expressed in pancreas and muscle. Isoform 1 and isoform 2 are expressed in the majority of the examined cell types. Isoform 2 is specifically expressed in skin, lung, dura and aorta.
  • Involvement in disease

    Defects in PLOD2 are the cause of Bruck syndrome type 2 (BRKS2) [MIM:609220]. Bruck syndrome, also known as osteogenesis imperfecta with congenital joint contractures, is an autosomal recessive disease characterized by generalized osteopenia, joint contractures at birth, fragile bones and short stature. It can be distinguished from osteogenesis imperfecta by the absence of hearing loss and dentinogenesis imperfecta, and by the presence of clubfoot and congenital joint limitations. The molecular defect is an aberrant cross-linking of bone collagen, due to underhydroxylation of lysine residues within the telopeptides of type I collagen, whereas the lysine residues in the triple helix are normal.
  • Sequence similarities

    Contains 1 Fe2OG dioxygenase domain.
  • Cellular localization

    Rough endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-oxoglutarate 5-dioxygenase 2 antibody
    • LH2 antibody
    • Lysine hydroxylase 2 antibody
    • Lysyl hydroxylase 2 antibody
    • OTTHUMP00000215204 antibody
    • OTTHUMP00000215205 antibody
    • OTTHUMP00000215206 antibody
    • PLOD 2 antibody
    • Plod2 antibody
    • PLOD2_HUMAN antibody
    • Procollagen lysine 2 oxoglutarate 5 dioxygenase 2 antibody
    • Procollagen lysine, 2 oxoglutarate 5 dioxygenase (lysine hydroxylase) 2 antibody
    • Procollagen-lysine antibody
    • Telopeptide lysyl hydroxylase antibody
    • TLH antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human bronchial epithelial tissue labelling PLOD2/LH2 with ab90088 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - PLOD2. Right - Merge.

  • Anti-PLOD2/LH2 antibody (ab90088) at 1 µg/ml (in 5% skim milk / PBS buffer) + DU145 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 85 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Shao S  et al. Lysyl Hydroxylase Inhibition by Minoxidil Blocks Collagen Deposition and Prevents Pulmonary Fibrosis via TGF-ß1/Smad3 Signaling Pathway. Med Sci Monit 24:8592-8601 (2018). Read more (PubMed: 30481795) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up