Overview

  • Product name

    Anti-PLRP2 antibody - C-terminal
    See all PLRP2 primary antibodies
  • Description

    Rabbit polyclonal to PLRP2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Pig
  • Immunogen

    Synthetic peptide within Human PLRP2 aa 329-378 (C terminal). The exact sequence is proprietary.
    Sequence:

    YADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIA


    Database link: P54317

  • Positive control

    • Human stomach tumor lysate.
  • General notes

     This product was previously labelled as Pancreatic Lipase Related Protein 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab182332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa.

Target

Images

  • Anti-PLRP2 antibody - C-terminal (ab182332) at 1 µg/ml + Human stomach tumor lysate at 10 µg

    Predicted band size: 52 kDa

References

ab182332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up