Overview

  • Product name

  • Description

    Rabbit polyclonal to PLS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PLS1 aa 1-143.
    Sequence:

    MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGY KVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKRE GITAIGGTSTISSEGTQHSYSEEEKVAFVNWINKALENDPDCK


    Database link: Q14651

  • Positive control

    • WB: HEK-293 and A549 whole cell lysates. IHC-P: Human small intestine and kidney tissues. ICC/IF: A549 cells. IP: HEK-293 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 70 kDa.
IP 1/200 - 1/2000.
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Fimbrin is a 68-kD actin-bundling protein.
  • Cellular localization

    Cytoplasm
  • Database links

  • Alternative names

    • Fimbrin antibody
    • I Fimbrin antibody
    • I Plastin antibody
    • Intestine specific plastin antibody
    • Plastin 1 (I isoform) antibody
    • Plastin 1 antibody
    • Plastin1 antibody
    see all

Images

  • All lanes : Anti-PLS1 antibody (ab236976) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 70 kDa

  • Paraffin-embedded human small intestine tissue stained for PLS1 using ab236976 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human kidney tissue stained for PLS1 using ab236976 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • A549 (human lung carcinoma cell line) cells stained for PLS1 (green) using ab236976 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counterstained wit DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

  • PLS1 was immunoprecipitated from 500 µg HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate with ab236976 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HEK-293 whole cell lysate.

    Lane 2: ab236976 IP in HEK-293 whole cell lysate.

    Lane 3: HEK-293 whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up