Overview

  • Product name

  • Description

    Rabbit polyclonal to PLSCR4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PLSCR4 aa 1-303. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPT GYPGGLPMGYYSPQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWM PGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSD QMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCF CCPSARQELEVQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPC STYGCGSDSVFEVKSLDGISNIGSIIRKWNGLLSAMADADHFDIHFPLDL DVK


    Database link: Q9NRQ2

  • Positive control

    • WB: Pig lung lysate; Mouse stomach lysate; Recombinant human PLSCR4 protein. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, uterus, small intestine and colon. Not detected in peripheral blood lymphocytes.
  • Sequence similarities

    Belongs to the phospholipid scramblase family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AV245873 antibody
    • Ca(2+)-dependent phospholipid scramblase 4 antibody
    • Cell growth inhibiting protein 43 antibody
    • Cell growth-inhibiting gene 43 protein antibody
    • GIG43 antibody
    • Phospholipid scramblase 4 antibody
    • PL scramblase 4 antibody
    • Pls4 antibody
    • PLS4_HUMAN antibody
    • Plscr4 antibody
    • TRA1 antibody
    see all

Images

  • Anti-PLSCR4 antibody (ab233005) at 2 µg/ml + recombinant human PLSCR4 protein
  • Anti-PLSCR4 antibody (ab233005) at 3 µg/ml + Pig lung lysate
  • Anti-PLSCR4 antibody (ab233005) at 3 µg/ml + Mouse stomach lysate
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PLSCR4 using ab233005 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab233005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up