Overview

  • Product name

    Anti-PM5 antibody
  • Description

    Rabbit polyclonal to PM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PM5 aa 918-1044.
    Sequence:

    NLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTV SSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQ LKAEGNDHIERALPHHRVIEVGNNDID


    Database link: Q15155

  • Positive control

    • WB: HeLa cell lysate. IHC-P: Human pancreatic cancer and skeletal muscle tissue. ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as NOMO1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/20 - 1/200.

Target

  • Function

    May antagonize Nodal signaling.
  • Tissue specificity

    Expressed in colon tumor tissue and in adjacent normal colonic mucosa.
  • Developmental stage

    No difference between normal colonic mucosa and colon tumor tissue in mRNA expression, whereas the protein is expressed 1.5-fold more in normal colonic mucosa that in colon tumor tissue.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Nodal modulator 1 antibody
    • NOMO 1 antibody
    • Nomo antibody
    • NOMO1 antibody
    • NOMO1_HUMAN antibody
    • PM5 antibody
    • pM5 protein antibody
    • pM5 protein telomeric copy antibody
    see all

Images

  • Anti-PM5 antibody (ab236915) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human pancreatic cancer tissue stained for PM5 using ab236915 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human skeletal muscle tissue stained for PM5 using ab236915 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for PM5 using ab236915 at 1/33 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab236915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up