Anti-PMF-1 antibody (ab222148)
Key features and details
- Rabbit polyclonal to PMF-1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PMF-1 antibody
See all PMF-1 primary antibodies -
Description
Rabbit polyclonal to PMF-1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PMF-1 aa 3-70.
Sequence:EASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAA GSYQRFTDCYKCFYQLQP
Database link: Q6P1K2 -
Positive control
- ICC/IF: HEK-293 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab222148 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT. -
Tissue specificity
Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver. -
Cellular localization
Nucleus. Chromosome > centromere > kinetochore. Associated with the kinetochore. - Information by UniProt
-
Database links
- Entrez Gene: 100527963 Human
- Entrez Gene: 11243 Human
- Omim: 609176 Human
- SwissProt: Q6P1K2 Human
- Unigene: 530479 Human
- Unigene: 654541 Human
-
Alternative names
- NNF1R antibody
- PMF 1 antibody
- PMF-1 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PMF-1 antibody (ab222148)PFA-fixed, Triton X-100 permeabilized HEK-293 (human epithelial cell line from embryonic kidney) cells stained for PMF-1 (green) using ab222148 at 4 µg/ml in ICC/IF.
Protocols
Datasheets and documents
References (0)
ab222148 has not yet been referenced specifically in any publications.
