Overview

  • Product name

  • Description

    Rabbit polyclonal to PMF-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PMF-1 aa 3-70.
    Sequence:

    EASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAA GSYQRFTDCYKCFYQLQP


    Database link: Q6P1K2

  • Positive control

    • ICC/IF: HEK-293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
  • Tissue specificity

    Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Associated with the kinetochore.
  • Information by UniProt
  • Database links

  • Alternative names

    • NNF1R antibody
    • PMF 1 antibody
    • PMF-1 antibody
    • Pmf1 antibody
    • PMF1_HUMAN antibody
    • Polyamine modulated factor 1 antibody
    • Polyamine-modulated factor 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HEK-293 (human epithelial cell line from embryonic kidney) cells stained for PMF-1 (green) using ab222148 at 4 µg/ml in ICC/IF.

References

ab222148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up