Overview

  • Product name

  • Description

    Rabbit polyclonal to PMM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PMM1 aa 2-262.
    Sequence:

    AVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVV GGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLG EELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERI EFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYC LDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCR EIFFPETAHEA


    Database link: Q92871

  • Positive control

    • WB: HepG2, NIH/3T3 and HEK-293T whole cell lysate; Mouse brain tissue lysate. IHC-P: Human pancreatic tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/200. Predicted molecular weight: 29 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain.
  • Tissue specificity

    Strong expression in liver, heart, brain, and pancreas; lower expression in skeletal muscle.
  • Pathway

    Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 2/2.
  • Sequence similarities

    Belongs to the eukaryotic PMM family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Brain glucose-1,6-bisphosphatase antibody
    • Phosphomannomutase 1 antibody
    • PMM 1 antibody
    • pmm1 antibody
    • PMM1_HUMAN antibody
    • PMMH 22 antibody
    • PMMH-22 antibody
    • PMMH22 antibody
    • Sec53 antibody
    see all

Images

  • All lanes : Anti-PMM1 antibody (ab236109) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 4 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 29 kDa

  • Paraffin-embedded human pancreatic tissue stained for PMM1 using ab236109 at 1/100 dilution in immunohistochemical analysis.

References

ab236109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up