Overview

  • Product name
    Anti-PMP70 antibody [CL2524]
    See all PMP70 primary antibodies
  • Description
    Mouse monoclonal [CL2524] to PMP70
  • Host species
    Mouse
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human PMP70 aa 410-474.
    Sequence:

    MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDL NFEVRSGANVLICGP


    Database link: P28288

  • Epitope
    ab211533 binds to an epitope located within the peptide sequence GVQVIPLIPGAGEII (aa 420-434) as determined by overlapping synthetic peptides.
  • Positive control
    • Human rectum, prostate, liver, kidney, fallopian tube and small intestine tissues; HeLa, A431, MCF7, U2OS and U251 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab211533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Probable transporter. The nucleotide-binding fold acts as an ATP-binding subunit with ATPase activity.
  • Sequence similarities
    Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.
    Contains 1 ABC transmembrane type-1 domain.
    Contains 1 ABC transporter domain.
  • Cellular localization
    Peroxisome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 70 kDa peroxisomal membrane protein antibody
    • ABC 43 antibody
    • ABC D3 antibody
    • ABC43 antibody
    • ABCD 3 antibody
    • Abcd3 antibody
    • ABCD3 protein antibody
    • ABCD3_HUMAN antibody
    • ATP binding cassette sub family D (ALD) member 3 antibody
    • ATP binding cassette sub family D member 3 antibody
    • ATP-binding cassette sub-family D member 3 antibody
    • CBAS5 antibody
    • dJ824O18.1 (ATP-binding cassette, sub family D (ALD), member 3 (PMP70, PXMP1)) antibody
    • Peroxisomal membrane protein 1 (70kD) antibody
    • Peroxisomal membrane protein 1 (70kD, Zellweger syndrome) antibody
    • Peroxisomal membrane protein 1 antibody
    • PMP 70 antibody
    • PMP70 antibody
    • PXMP 1 antibody
    • PXMP1 antibody
    • ZWS2 antibody
    see all

Images

  • Immunofluorescent analysis of paraformalin-fixed, Triton X-100 permeabilized U251 cells labeling PMP70 with ab211533 at 4 μg/ml. Microtubule- and nuclear probes are visualized in red and blue respectively.

  • Immunofluorescent analysis of paraformalin-fixed, Triton X-100 permeabilized U2OS cells labeling PMP70 with ab211533 at 4 μg/ml dilution. Microtubule- and nuclear probes are visualized in red and blue respectively.

  • Immunofluorescent analysis of paraformalin-fixed, Triton X-100 permeabilized MCF7 cells labeling PMP70 with ab211533 at 4 μg/ml dilution. Microtubule- and nuclear probes are visualized in red and blue respectively.

  • Immunofluorescent analysis of paraformalin-fixed, Triton X-100 permeabilized A431 cells labeling PMP70 with ab211533 at 4 μg/ml dilution. Microtubule- and nuclear probes are visualized in red and blue respectively.

  • Immunofluorescent analysis of paraformalin-fixed, Triton X-100 permeabilized HeLa cells labeling PMP70 with ab211533 at 4 μg/ml dilution. Microtubule- and nuclear probes are visualized in red and blue respectively.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling PMP70 with ab211533 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling PMP70 with ab211533 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fallopian tube tissue labeling PMP70 with ab211533 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human liver tissue labeling PMP70 with ab211533 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate tissue labeling PMP70 with ab211533 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human rectum tissue labeling PMP70 with ab211533 at 1/200 dilution.

References

This product has been referenced in:
  • Cai M  et al. Disruption of peroxisome function leads to metabolic stress, mTOR inhibition, and lethality in liver cancer cells. Cancer Lett 421:82-93 (2018). ICC/IF . Read more (PubMed: 29458144) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211533.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up