Overview

  • Product name

    Anti-PMPCA/INPP5E antibody
    See all PMPCA/INPP5E primary antibodies
  • Description

    Rabbit polyclonal to PMPCA/INPP5E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant fragment corresponding to Human PMPCA/INPP5E aa 186-370.
    Sequence:

    MAVQFELEDLNLRPDPEPLLTEMIHEAAYRENTVGLHRFCPTENVAKINR EVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGSAEAVD IDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFI PFAVLNMMMGGGGSFSAGGPGKGMFSRLYLNVLNR

  • Positive control

    • MCF7 and A549 cell lysates; Human fetal colon tissue.
  • General notes

     This product was previously labelled as PMPCA

     

Properties

Applications

Our Abpromise guarantee covers the use of ab140171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 58 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Cleaves presequences (transit peptides) from mitochondrial protein precursors.
  • Sequence similarities

    Belongs to the peptidase M16 family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1200002L24Rik antibody
    • 4933435E07Rik antibody
    • Alpha MPP antibody
    • Alpha-MPP antibody
    • FLJ26258 antibody
    • Inositol polyphosphate 5 phosphatase, 72 kD antibody
    • INPP5E antibody
    • KIAA0123 antibody
    • MGC104197 antibody
    • MGC93916 antibody
    • Mitochondrial matrix processing protease, alpha subunit antibody
    • mitochondrial processing peptidase subunit alpha antibody
    • Mitochondrial-processing peptidase subunit alpha antibody
    • MPPA_HUMAN antibody
    • P 55 antibody
    • P-55 antibody
    • Peptidase (mitochondrial processing) alpha antibody
    • pmpca antibody
    • RP11-413M3.1 antibody
    • RP23-306D20.8 antibody
    • SCAR2 antibody
    see all

Images

  • All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution

    Lane 1 : Mouse whole brain homogenate
    Lane 2 : Mice brain non-synaptosomal mitochondria
    Lane 3 : Mitochondria from ST-Hdh-Q7/Q7 striatal cells
    Lane 4 : Mitochondria from ST-Hdh-Q111/Q111 striatal cells
    Lane 5 : HEK293 whole cell homogenate
    Lane 6 : Mitochondria from HEK293 cells

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : IRDye 800CY-conjugated monoclonal goat anti-rabbit IgG at 1/15000 dilution

    Performed under reducing conditions.

    Predicted band size: 58 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 40 kDa (possible non-specific binding)


    Exposure time: 5 minutes


    Protein standard (bands from the top to the bottom: 250, 150, 100, 75 (yellow), 50, 37, 25 (yellow), 20, 15 kDa.

    Blocked for 1 hour at 25°C. Incubated with the primary antibody for 16 hours at 4°C.

    See Abreview

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labelling PMPCA/INPP5E with ab140171 at 1/100 dilution.

  • All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution

    Lane 1 : MCF7 cell lysate
    Lane 2 : A549 cell lysate

    Predicted band size: 58 kDa

References

ab140171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Brain tissue, striatal cells.)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
20 µg
Specification
Brain tissue, striatal cells.
Blocking step
SEA BLOCK Blocking buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Svitlana Yablonska

Verified customer

Submitted Jun 01 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up