Anti-PMPCA/INPP5E antibody (ab140171)
Key features and details
- Rabbit polyclonal to PMPCA/INPP5E
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PMPCA/INPP5E antibody
See all PMPCA/INPP5E primary antibodies -
Description
Rabbit polyclonal to PMPCA/INPP5E -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Dog -
Immunogen
Recombinant fragment corresponding to Human PMPCA/INPP5E aa 186-370.
Sequence:MAVQFELEDLNLRPDPEPLLTEMIHEAAYRENTVGLHRFCPTENVAKINR EVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGSAEAVD IDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFI PFAVLNMMMGGGGSFSAGGPGKGMFSRLYLNVLNR
-
Positive control
- MCF7 and A549 cell lysates; Human fetal colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 98% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab140171 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/1000 - 1/2000. Predicted molecular weight: 58 kDa.
|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
WB
1/1000 - 1/2000. Predicted molecular weight: 58 kDa. |
IHC-P
1/100 - 1/500. |
Target
-
Function
Cleaves presequences (transit peptides) from mitochondrial protein precursors. -
Sequence similarities
Belongs to the peptidase M16 family. -
Cellular localization
Mitochondrion matrix. - Information by UniProt
-
Database links
- Entrez Gene: 480677 Dog
- Entrez Gene: 23203 Human
- Entrez Gene: 66865 Mouse
- Entrez Gene: 296588 Rat
- Omim: 613036 Human
- SwissProt: Q10713 Human
- SwissProt: Q9DC61 Mouse
- SwissProt: P20069 Rat
see all -
Alternative names
- 1200002L24Rik antibody
- 4933435E07Rik antibody
- Alpha MPP antibody
see all
Images
-
All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution
Lane 1 : Mouse whole brain homogenate
Lane 2 : Mice brain non-synaptosomal mitochondria
Lane 3 : Mitochondria from ST-Hdh-Q7/Q7 striatal cells
Lane 4 : Mitochondria from ST-Hdh-Q111/Q111 striatal cells
Lane 5 : HEK293 whole cell homogenate
Lane 6 : Mitochondria from HEK293 cells
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : IRDye 800CY-conjugated monoclonal goat anti-rabbit IgG at 1/15000 dilution
Performed under reducing conditions.
Predicted band size: 58 kDa
Observed band size: 50 kDa why is the actual band size different from the predicted?
Additional bands at: 40 kDa (possible non-specific binding)
Exposure time: 5 minutesProtein standard (bands from the top to the bottom: 250, 150, 100, 75 (yellow), 50, 37, 25 (yellow), 20, 15 kDa.
Blocked for 1 hour at 25°C. Incubated with the primary antibody for 16 hours at 4°C.
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labelling PMPCA/INPP5E with ab140171 at 1/100 dilution.
-
All lanes : Anti-PMPCA/INPP5E antibody (ab140171) at 1/1000 dilution
Lane 1 : MCF7 cell lysate
Lane 2 : A549 cell lysate
Predicted band size: 58 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab140171 has not yet been referenced specifically in any publications.