Overview

  • Product name

    Anti-PMPCA/INPP5E antibody
    See all PMPCA/INPP5E primary antibodies
  • Description

    Rabbit polyclonal to PMPCA/INPP5E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PMPCA/INPP5E aa 364-441.
    Sequence:

    YLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFI LMGGTVDTVELERAKTQLTSMLMMNLES


    Database link: Q10713

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver lysate; MCF7 cells.
  • General notes

     This product was previously labelled as PMPCA

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 58 kDa.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling PMPCA/INPP5E with ab221117 at 4 µg/ml (green).

  • All lanes : Anti-PMPCA/INPP5E antibody (ab221117) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate

    Predicted band size: 58 kDa

References

ab221117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up