Overview

  • Product name

  • Description

    Rabbit polyclonal to PN-I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PN-I aa 61-185.
    Sequence:

    RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNII DNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLL VQQALPKAKLKEIVAESDVMLKEGY


    Database link: Q9H0P0

  • Positive control

    • WB: PN-I overexpression HEK-293T cell lysate. IHC-P: Human rectum tissue.
  • General notes

    Previously labelled as NT5C3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 38 kDa.

Target

  • Function

    Can act both as nucleotidase and as phosphotransferase.
  • Tissue specificity

    Isoform 1 and isoform 3 are expressed in reticulocytes and lymphocytes. Isoform 4 is expressed only in reticulocytes.
  • Involvement in disease

    P5N deficiency
  • Sequence similarities

    Belongs to the pyrimidine 5'-nucleotidase family.
  • Cellular localization

    Cytoplasm and Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5NT3A_HUMAN antibody
    • cN III antibody
    • cN-III antibody
    • cNIII antibody
    • Cytosolic 5' nucleotidase 3 antibody
    • Cytosolic 5' nucleotidase III antibody
    • Cytosolic 5''-nucleotidase 3 antibody
    • Cytosolic 5''-nucleotidase 3A antibody
    • Cytosolic 5''-nucleotidase III antibody
    • NT5C3 antibody
    • Nt5c3a antibody
    • p36 antibody
    • P5''N-1 antibody
    • P5'N 1 antibody
    • P5'N1 antibody
    • P5N 1 antibody
    • P5N-1 antibody
    • P5N1 antibody
    • PN I antibody
    • PN-I antibody
    • PNI antibody
    • PSN1 antibody
    • Pyrimidine 5' nucleotidase 1 antibody
    • Pyrimidine 5''-nucleotidase 1 antibody
    • UMPH antibody
    • UMPH1 antibody
    • Uridine 5' monophosphate hydrolase 1 antibody
    • Uridine 5''-monophosphate hydrolase 1 antibody
    see all

Images

  • Paraffin-embedded human rectum tissue stained for PN-I using ab224766 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-PN-I antibody (ab224766) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PN-I overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Developed using the ECL technique.

    Predicted band size: 38 kDa

References

ab224766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up