Overview

  • Product name

  • Description

    Rabbit polyclonal to PNKD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PNKD aa 164-342.
    Sequence:

    TLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDV VSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRT FEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARER KMQWVQRQRLERKGTCPSTLGEERSYNPF

  • Positive control

    • Human uterine cancer tissue and Human fetal liver lysate.
  • General notes

    Previously labelled as Probable hydrolase PNKD.

Properties

Applications

Our Abpromise guarantee covers the use of ab140115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 43 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.
  • Tissue specificity

    Isoform 1 is only expressed in the brain. Isoform 2 is ubiquitously detected with highest expression in skeletal muscle and detected in myocardial myofibrils. Variant Val-7 and Val-9 are detected in the brain only.
  • Involvement in disease

    Defects in PNKD are the cause of dystonia type 8 (DYT8) [MIM:118800]. DYT8 is a paroxysmal non-kinesigenic dystonia/dyskinesia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT8 is characterized by attacks of involuntary movements brought on by stress, alcohol, fatigue or caffeine. The attacks generally last between a few seconds and four hours or longer. The attacks may begin in one limb and spread throughout the body, including the face.
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
  • Post-translational
    modifications

    Isoform 2 is phosphorylated at Ser-121 upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus; Mitochondrion and Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2210013N15Rik antibody
    • 2810403H05Rik antibody
    • AI854243 antibody
    • BRAIN PROTEIN 17 antibody
    • BRP17 antibody
    • DYT8 antibody
    • FKSG19 antibody
    • FPD1 antibody
    • KIAA1184 antibody
    • KIPP1184 antibody
    • MNCb-5687 antibody
    • MR-1 antibody
    • MR1 antibody
    • Myofibrillogenesis regulator 1 antibody
    • Paroxysmal nonkinesiogenic dyskinesia protein antibody
    • PDC antibody
    • PKND1 antibody
    • Pnkd antibody
    • PNKD_HUMAN antibody
    • Probable hydrolase PNKD antibody
    • TAHCCP2 antibody
    • Trans-activated by hepatitis C virus core protein 2 antibody
    see all

Images

  • Anti-PNKD antibody (ab140115) at 1/500 dilution + Human fetal liver lysate

    Predicted band size: 43 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human uterine cancer tissue labelling PNKD with ab140115 at 1/100.

References

ab140115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up