Anti-PNPLA8 antibody (ab223726)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PNPLA8 antibody
See all PNPLA8 primary antibodies -
Description
Rabbit polyclonal to PNPLA8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PNPLA8 aa 141-228.
Sequence:DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLF HYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Database link: Q9NP80 -
Positive control
- WB: U-2197 cell lysate. ICC/IF: U-2 OS cells. HC-P: Human duodenum tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223726 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/250. Predicted molecular weight: 88 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids. -
Tissue specificity
Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart. -
Sequence similarities
Contains 1 patatin domain. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasm > perinuclear region. - Information by UniProt
-
Database links
- Entrez Gene: 50640 Human
- Omim: 612123 Human
- SwissProt: Q9NP80 Human
- Unigene: 617340 Human
- Unigene: 732217 Human
-
Alternative names
- Calcium-independent phospholipase A2-gamma antibody
- Intracellular membrane associated calcium independent phospholipase A2 gamma antibody
- Intracellular membrane-associated calcium-independent phospholipase A2 gamma antibody
see all
Images
-
Western blot - Anti-PNPLA8 antibody (ab223726)Anti-PNPLA8 antibody (ab223726) at 1/100 dilution + U-2197 cell lysate
Predicted band size: 88 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-PNPLA8 antibody (ab223726)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PNPLA8 (green) using ab223726 (4 µg/ml) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PNPLA8 antibody (ab223726)Paraffin embedded human duodenum tissue stained for PNPLA8 with ab223726 (1/50 dilution) in immunohistochemical analysis.
Protocols
Datasheets and documents
References
ab223726 has not yet been referenced specifically in any publications.
