Anti-PNPLA8 antibody (ab223726)
Key features and details
- Rabbit polyclonal to PNPLA8
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PNPLA8 antibody
See all PNPLA8 primary antibodies -
Description
Rabbit polyclonal to PNPLA8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PNPLA8 aa 141-228.
Sequence:DSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLF HYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENE
Database link: Q9NP80 -
Positive control
- WB: U-2197 cell lysate. ICC/IF: U-2 OS cells. HC-P: Human duodenum tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223726 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 88 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids. -
Tissue specificity
Expressed in parenchymal tissues including heart, skeletal muscle, placenta, brain, liver and pancreas. Also expressed in bronchial epithelial cells and kidney. Highest expression is observed in skeletal muscle and heart. -
Sequence similarities
Contains 1 patatin domain. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasm > perinuclear region. - Information by UniProt
-
Database links
- Entrez Gene: 50640 Human
- Omim: 612123 Human
- SwissProt: Q9NP80 Human
- Unigene: 617340 Human
- Unigene: 732217 Human
-
Alternative names
- Calcium-independent phospholipase A2-gamma antibody
- Intracellular membrane associated calcium independent phospholipase A2 gamma antibody
- Intracellular membrane-associated calcium-independent phospholipase A2 gamma antibody
see all
Images
-
Anti-PNPLA8 antibody (ab223726) at 1/100 dilution + U-2197 cell lysate
Predicted band size: 88 kDa -
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PNPLA8 (green) using ab223726 (4 µg/ml) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PNPLA8 antibody (ab223726)
Paraffin embedded human duodenum tissue stained for PNPLA8 with ab223726 (1/50 dilution) in immunohistochemical analysis.
Protocols
Datasheets and documents
References (0)
ab223726 has not yet been referenced specifically in any publications.