Overview

  • Product name

  • Description

    Rabbit polyclonal to PNR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human PNR aa 1-34.
    Sequence:

    MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQ


    Database link: O14804

  • Positive control

    • IHC-P: Human brain tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.
  • Tissue specificity

    Expressed almost exclusively in skeletal muscle and selected areas of the brain, such amygdala, hippocampus, caudate nucleus, thalamus and hypothalamus. Weak expression is also find in substantia nigra.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dGATA A antibody
    • GATA binding factor A antibody
    • Photoreceptor specific nuclear receptor fragment antibody
    • PNR antibody
    • Putative neurotransmitter receptor antibody
    • Taar5 antibody
    • TAAR5_HUMAN antibody
    • TaR-5 antibody
    • Trace amine associated receptor 5 antibody
    • Trace amine receptor 5 antibody
    • Trace amine-associated receptor 5 antibody
    • Transcription factor GATA A antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for PNR using ab236908 at 1/600 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PNR (green) using ab236908 at 1/200 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab236908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up