Overview

  • Product name

  • Description

    Rabbit polyclonal to PNRC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PNRC2 aa 1-139.
    Sequence:

    MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYN SSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSE PPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV


    Database link: Q9NPJ4-1

  • Positive control

    • WB: U-251 MG whole cell lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.

Target

  • Function

    Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for UPF1/RENT1 localization to the P-body. Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure.
  • Tissue specificity

    Expressed in heart, lung, muscle and brain.
  • Sequence similarities

    Belongs to the PNRC family. PNRC2 subfamily.
  • Domain

    The interaction between PNRC2 and nuclear receptors is dependent on the SH3 binding motif.
  • Cellular localization

    Nucleus. Cytoplasm > P-body.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610011E17Rik antibody
    • D4Bwg0593e antibody
    • FLJ20312 antibody
    • MGC11707 antibody
    • MGC93828 antibody
    • MGC99541 antibody
    • OTTMUSP00000010360 antibody
    • OTTMUSP00000010366 antibody
    • pnrc2 antibody
    • PNRC2_HUMAN antibody
    • Proline rich nuclear receptor coactivator 2 antibody
    • Proline-rich nuclear receptor coactivator 2 antibody
    • RP11-4M23.5 antibody
    • RP23-161N17.3 antibody
    see all

Images

  • Anti-PNRC2 antibody (ab235599) at 1/500 dilution + U-251 MG (human brain glioma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human kidney tissue stained for PNRC2 using ab235599 at 1/100 dilution in immunohistochemical analysis.

References

ab235599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up