Overview

  • Product name

  • Description

    Rabbit polyclonal to POC1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Rat POC1A aa 242-291 (C terminal).
    Sequence:

    SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD


    Database link: NP_001102766

  • Positive control

    • Rat pancreas lysate
  • General notes

     This product was previously labelled as WDR51A

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab135361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa.

Target

  • Function

    Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Required for ciliogenesis.
  • Involvement in disease

    Defects in POC1A are the cause of short stature, onychodysplasia, facial dysmorphism, and hypotrichosis (SOFT) [MIM:614813]. A syndrome characterized by severely short long bones, peculiar facies associated with paucity of hair, and nail anomalies. Growth retardation is evident on prenatal ultrasound as early as the second trimester of pregnancy, and affected individuals reach a final stature consistent with a height age of 6 years to 8 years. Relative macrocephaly is present during early childhood but head circumference is markedly low by adulthood. Psychomotor development is normal. Facial dysmorphism includes a long, triangular face with prominent nose and small ears, and affected individuals have an unusual high-pitched voice. Clinodactyly, brachydactyly, and hypoplastic distal phalanges and fingernails are present in association with postpubertal sparse and short hair. Typical skeletal findings include short and thick long bones with mild irregular metaphyseal changes, short femoral necks, and hypoplastic pelvis and sacrum. All long bones of the hand are short, with major delay of carpal ossification and cone-shaped epiphyses. Vertebral body ossification is also delayed. Note=Cells derived from affected individuals have abnormal mitotic mechanics with multipolar spindles, in addition to clearly impaired ciliogenesis.
  • Sequence similarities

    Belongs to the WD repeat POC1 family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm > cytoskeleton > cilium basal body. Component of both mother and daughter centrioles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Pix2 antibody
    • POC1 centriolar protein homolog A (Chlamydomonas) antibody
    • POC1 centriolar protein homolog A antibody
    • Poc1a antibody
    • POC1A_HUMAN antibody
    • WD repeat containing protein 51A antibody
    • WD repeat domain 51A antibody
    • WD repeat-containing protein 51A antibody
    see all

Images

  • Anti-POC1A antibody (ab135361) at 1 µg/ml + Rat pancreas lysate at 10 µg

    Predicted band size: 40 kDa

References

This product has been referenced in:

  • Geister KA  et al. LINE-1 Mediated Insertion into Poc1a (Protein of Centriole 1 A) Causes Growth Insufficiency and Male Infertility in Mice. PLoS Genet 11:e1005569 (2015). IHC . Read more (PubMed: 26496357) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up