Overview

  • Product name

    Anti-POC1B antibody
  • Description

    Rabbit polyclonal to POC1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human POC1B aa 299-478.
    Sequence:

    TNFDELHCKGLTKRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEINPK LEVIDLQISTPPVMDILSFDSTTTTETSGRTLPDKGEEACGYFLNPSLMS PECLPTTTKKKTEDMSDLPCESQRSIPLAVTDALEHIMEQLNVLTQTVSI LEQRLTLTEDKLKDCLENQQKLFSAVQQKS


    Database link: Q8TC44-1

  • Positive control

    • WB: Mouse small intestine tissue lysate. IHC-P: Human bladder cancer and testis tissues.
  • General notes

     This product was previously labelled as WDR51B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 49,54 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Required for ciliogenesis.
  • Sequence similarities

    Belongs to the WD repeat POC1 family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm > cytoskeleton > cilium basal body. Component of both mother and daughter centrioles.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4933430F16Rik antibody
    • FLJ14923 antibody
    • FLJ41111 antibody
    • Pix1 antibody
    • POC1 centriolar protein homolog B (Chlamydomonas) antibody
    • POC1 centriolar protein homolog B antibody
    • POC1B antibody
    • POC1B_HUMAN antibody
    • TUWD12 antibody
    • WD repeat containing protein 51B antibody
    • WD repeat domain 51B antibody
    • WD repeat-containing protein 51B antibody
    • WDR51B antibody
    see all

Images

  • Anti-POC1B antibody (ab230031) at 1/1000 dilution + mouse small intestine tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 49,54 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human testis tissue stained for POC1B using ab230031 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder cancer tissue stained for POC1B using ab230031 at 1/100 dilution in immunohistochemical analysis.

References

ab230031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up