Overview

  • Product name

    Anti-POGK antibody
  • Description

    Rabbit polyclonal to POGK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human POGK aa 101-400.
    Sequence:

    GEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQFPQPQHFDSF GLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSY DAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRA FRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE KGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALR RAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITA


    Database link: Q9P215

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 1 DDE domain.
    Contains 1 HTH CENPB-type DNA-binding domain.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BASS 2 antibody
    • BASS2 antibody
    • KIAA1513 antibody
    • KIAA15131 antibody
    • LST003 antibody
    • POGK antibody
    • POGK_HUMAN antibody
    • Pogo transposable element with KRAB domain antibody
    • SLTP003 antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for POGK (Green) using ab238905 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for POGK with ab238905 at a 1/100 dilution in immunohistochemical analysis.

References

ab238905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up