Overview

  • Product name

  • Description

    Rabbit polyclonal to POGZ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human POGZ aa 1-562 (N terminal).
    Sequence:

    MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVS APVPIAAHASVAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLV QQGGQPLILTQNPAPGLGTMVTQPVLRPVQVMQNANHVTSSPVASQPIFI TTQGFPVRNVRPVQNAMNQVGIVLNVQQGQTVRPITLVPAPGTQFVKPTV GVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTK STPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIAS FVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQR TSGPESSMKVTSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPE MVEYQKKGKSLDSEPSVPSAAKPPSPEKTAPVASTPSSTPIPALSPPTKV PEPNENVGDAVQTKLIMLVDDFYYGRDGGKVAQLTNFPKVATSFRCPHCT KRLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLE NVHSPYESTTKC


    Database link: Q7Z3K3

  • Positive control

    • HeLa cells; HeLa cells transfected with POGZ siRNA.

Properties

Applications

Our Abpromise guarantee covers the use of ab171934 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 155 kDa.
ICC/IF 1/500.
IP Use at an assay dependent concentration.

Target

  • Function

    Plays a role in mitotic cell cycle progression and is involved in kinetochore assembly and mitotic sister chromatid cohesion. Probably through its association with CBX5 plays a role in mitotic chromosome segregation by regulating aurora kinase B/AURKB activation and AURKB and CBX5 dissociation from chromosome arms.
  • Sequence similarities

    Contains 9 C2H2-type zinc fingers.
    Contains 1 DDE domain.
    Contains 1 HTH CENPB-type DNA-binding domain.
  • Cellular localization

    Nucleus. Chromosome. Cytoplasm. According to some authors, it is not localized to mitotic chromatin (PubMed:19244240). Recruited to trimethylated 'Lys-9' of histone H3.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0461 antibody
    • MGC71543 antibody
    • Pogo transposable element with ZNF domain antibody
    • POGZ antibody
    • POGZ_HUMAN antibody
    • putative protein product of Nbla00003 antibody
    • SUHW5 antibody
    • suppressor of hairy wing homolog antibody
    • Suppressor of hairy wing homolog 5 antibody
    • Zinc finger protein 280E antibody
    • Zinc finger protein 635 antibody
    • ZNF280E antibody
    • ZNF635 antibody
    • ZNF635M antibody
    see all

Images

  • All lanes : Anti-POGZ antibody (ab171934) at 1/1000 dilution

    Lane 1 : Crude extract of HeLa cells transfected with control siRNA
    Lane 2 : Crude extract of HeLa cells transfected with POGZ siRNA

    Predicted band size: 155 kDa

  • Immunofluorescenct analysis of HeLa cells (chromosome spread preparations) labeling POGZ with ab171934 at 1/500 dilution and stained with Hoechst 33342.

  • Immunofluorescent analysis of Paraformaldehyde-fixed HeLa cells labeling POGZ with ab171934 at 1/500 dilution and stained with Hoechst 33342.

References

This product has been referenced in:

  • Lee HS  et al. The chromatin remodeler RSF1 controls centromeric histone modifications to coordinate chromosome segregation. Nat Commun 9:3848 (2018). Read more (PubMed: 30242288) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Hela cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Hela cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up