Anti-POLD1 antibody (ab168827)
Key features and details
- Rabbit polyclonal to POLD1
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-POLD1 antibody
See all POLD1 primary antibodies -
Description
Rabbit polyclonal to POLD1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Horse, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan, Bat -
Immunogen
Synthetic peptide corresponding to Human POLD1 aa 50-100.
Sequence:LQEQEEEELQSVLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQL E
Database link: NP_002682.2 -
Positive control
- WB: HeLa, 293T, Jurkat, Mouse TCMK-1 and Mouse NIH3T3 whole cell lysates. IHC-P: Human ovarian carcinoma.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab168827 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/1000 - 1/5000.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 124 kDa.
|
Notes |
---|
IHC-P
1/1000 - 1/5000. |
WB
1/2000 - 1/10000. Predicted molecular weight: 124 kDa. |
Target
-
Function
Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex. -
Sequence similarities
Belongs to the DNA polymerase type-B family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 456228 Chimpanzee
- Entrez Gene: 5424 Human
- Entrez Gene: 18971 Mouse
- Omim: 174761 Human
- SwissProt: P28340 Human
- SwissProt: P52431 Mouse
- Unigene: 279413 Human
- Unigene: 16549 Mouse
-
Alternative names
- Polymerase (DNA directed) delta 1 catalytic subunit antibody
- CDC2 antibody
- CDC2 homolog antibody
see all
Images
-
All lanes : Anti-POLD1 antibody (ab168827) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : TCMK-1 whole cell lysate
Lane 5 : NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 124 kDa
Exposure time: 10 seconds -
Paraffin embedded human ovarian carcinoma tissue stained for POLD1 using ab168827 at 1/1000 dilution in immunohistochemical analysis.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab168827 has been referenced in 1 publication.
- Chen T et al. A hypomorphic mutation in Pold1 disrupts the coordination of embryo size expansion and morphogenesis during gastrulation. Biol Open 11:N/A (2022). PubMed: 35876795