Overview

  • Product name

  • Description

    Rabbit polyclonal to POLD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Horse, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan, Bat
  • Immunogen

    Synthetic peptide corresponding to Human POLD1 aa 50-100.
    Sequence:

    LQEQEEEELQSVLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQL E


    Database link: NP_002682.2

  • Positive control

    • HeLa, 293T, Jurkat, Mouse TCMK-1 and Mouse NIH3T3 whole cell lysates.
  • General notes

     This product was previously labelled as DNA Polymerase delta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 124 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function

      Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.
    • Sequence similarities

      Belongs to the DNA polymerase type-B family.
    • Cellular localization

      Nucleus.
    • Information by UniProt
    • Database links

    • Alternative names

      • Polymerase (DNA directed) delta 1 catalytic subunit antibody
      • CDC2 antibody
      • CDC2 homolog antibody
      • CRCS10 antibody
      • DNA directed DNA polymerase delta 1 antibody
      • DNA directed polymerase delta 1 antibody
      • DNA pol delta 1 antibody
      • DNA polymerase delta catalytic subunit antibody
      • DNA polymerase subunit delta p125 antibody
      • DPOD1_HUMAN antibody
      • MDPL antibody
      • POLD antibody
      • POLD 1 antibody
      • POLD1 antibody
      • Polymerase (DNA directed) delta 1 catalytic subunit 125kDa antibody
      • Polymerase (DNA) delta 1 catalytic subunit antibody
      • Polymerase DNA directed delta 1 catalytic subunit 125kD antibody
      • polymerase, DNA, delta antibody
      see all

    Images

    • All lanes : Anti-POLD1 antibody (ab168827) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate
      Lane 4 : TCMK-1 whole cell lysate
      Lane 5 : NIH3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 124 kDa


      Exposure time: 10 seconds

    References

    ab168827 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab168827.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up