Overview

  • Product name

  • Description

    Rabbit polyclonal to POLD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human POLD3 aa 269-344.
    Sequence:

    SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMR KKRRRIKLPESDSSEDEVFPDSPGAY


    Database link: Q15054

  • Positive control

    • Human stomach tissue; U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Required for optimal DNA polymerase delta activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA polymerase delta subunit 3 antibody
    • DNA polymerase delta subunit p66 antibody
    • DNA polymerase delta, subunit 3 antibody
    • DNA polymerase subunit delta p66 antibody
    • DPOD3_HUMAN antibody
    • KIAA0039 antibody
    • P66 antibody
    • P68 antibody
    • Pol delta C subunit (p66) antibody
    • Pold3 antibody
    • Polymerase (DNA directed), delta 3 antibody
    • Polymerase (DNA-directed), delta 3, accessory subunit antibody
    • PPP1R128 antibody
    • Protein phosphatase 1, regulatory subunit 128 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human stomach tissue labeling POLD3 with ab204740 at 1/500 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells labeling POLD3 with ab204740 at 4 µg/ml (green).

References

ab204740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up