Overview

  • Product name

    Anti-Poliovirus Receptor/PVR antibody
    See all Poliovirus Receptor/PVR primary antibodies
  • Description

    Rabbit polyclonal to Poliovirus Receptor/PVR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat Poliovirus Receptor/PVR aa 22-255. Expressed in E.coli.
    Sequence:

    LLSCFTLQKAGGEIAVQVLSNSTGFLGGSTVLHCSLASKDNVTITQLTWM KRDPDGSHPSVAVFHPKKGPSISDPERVKFLVAKVYEDLRNASLAISNLR VEDEGIYECQIATFPTGSKSANVWLKVFARPKNTAEALEPSPTLMPQDVA KCISADGHPPGRITWSSNVNGSYREMKETGSQPGTTTVISYLSMVPSSQA DGTNITCTVEHESFQEPDQQPLILSLPYPPEVSI


    Database link: Q5U334

  • Positive control

    • IHC-P: Rat kidney tissue. WB: Rat heart lysate; Recombinant rat poliovirus receptor/PVR protein.
  • General notes

     This product was previously labelled as Poliovirus Receptor

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231205 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function

    Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.
  • Sequence similarities

    Belongs to the nectin family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD155 antibody
    • CD155 antigen antibody
    • FLJ25946 antibody
    • HVED antibody
    • mE4 antibody
    • NECL 5 antibody
    • Necl-5 antibody
    • Necl5 antibody
    • Nectin like 5 antibody
    • Nectin like protein 5 antibody
    • Nectin-like protein 5 antibody
    • Ortholog of mouse Tage4 antibody
    • Poliovirus receptor antibody
    • PVR antibody
    • PVR_HUMAN antibody
    • PVS antibody
    • Taa1 antibody
    • Tage 4 antibody
    • TAGE4 antibody
    see all

Images

  • Anti-Poliovirus Receptor/PVR antibody (ab231205) at 2 µg/ml + Rat heart lysate

    Predicted band size: 45 kDa

  • Anti-Poliovirus Receptor/PVR antibody (ab231205) at 2 µg/ml + Recombinant rat poliovirus receptor/PVR protein

    Predicted band size: 45 kDa

  • Fomalin-fixed, paraffin-embedded rat kidney tissue stained for Poliovirus Receptor/PVR using ab231205 at 20 µg/mL in immunohistochemical analysis.

References

ab231205 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231205.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up