Anti-POLR1A antibody (ab222065)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-POLR1A antibody
See all POLR1A primary antibodies -
Description
Rabbit polyclonal to POLR1A -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human POLR1A aa 840-924.
Sequence:DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQF PENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR
Database link: O95602 -
Positive control
- ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab222065 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol I. A bridging helix emanates from RPA1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol I by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. -
Sequence similarities
Belongs to the RNA polymerase beta' chain family. -
Cellular localization
Nucleus > nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 25885 Human
- Entrez Gene: 20019 Mouse
- Entrez Gene: 83581 Rat
- SwissProt: O95602 Human
- SwissProt: O35134 Mouse
- SwissProt: O54889 Rat
- Unigene: 531818 Human
-
Alternative names
- A190 antibody
- AFDCIN antibody
- DNA-directed RNA polymerase I largest subunit antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-POLR1A antibody (ab222065)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for POLR1A (green) using ab222065 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab222065 has not yet been referenced specifically in any publications.
