Anti-POLR1A antibody (ab222065)

Submit a review Submit a question References (1)
Immunocytochemistry/ Immunofluorescence - Anti-POLR1A antibody (ab222065)

    Key features and details

    • Rabbit polyclonal to POLR1A
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    Overview

    • Product name

      Anti-POLR1A antibody
      See all POLR1A primary antibodies

    • Description

      Rabbit polyclonal to POLR1A

    • Host species

      Rabbit

    • Tested applications

      Suitable for: ICC/IFmore details

    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat

    • Immunogen

      Recombinant fragment corresponding to Human POLR1A aa 840-924.
      Sequence:

      DEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQF PENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGR


      Database link: O95602
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

    • Positive control

      • ICC/IF: U-2 OS cells.

    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    Applications

    Our Abpromise guarantee covers the use of ab222065 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 0.25 - 2 µg/ml.

    Fixation/Permeabilization: PFA/Triton X-100.

    Target

    • Function

      DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol I. A bridging helix emanates from RPA1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol I by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

    • Sequence similarities

      Belongs to the RNA polymerase beta' chain family.

    • Cellular localization

      Nucleus > nucleolus.
    • Information by UniProt

    • Database links

      • Alternative names

        • A190 antibody
        • AFDCIN antibody
        • DNA-directed RNA polymerase I largest subunit antibody
        • DNA-directed RNA polymerase I subunit A antibody
        • DNA-directed RNA polymerase I subunit rpa1 antibody
        • Polr1a antibody
        • Polymerase (RNA) I polypeptide A 194kDa antibody
        • RNA polymerase I 194 kDa subunit antibody
        • RNA polymerase I subunit A antibody
        • RNA polymerase I subunit A1 antibody
        • RPA1 antibody
        • RPA1_HUMAN antibody
        • RPA194 antibody
        • RPO1 4 antibody
        • RPO14 antibody
        see all

      Images

      • Immunocytochemistry/ Immunofluorescence - Anti-POLR1A antibody (ab222065)
        Immunocytochemistry/ Immunofluorescence - Anti-POLR1A antibody (ab222065)

        PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for POLR1A (green) using ab222065 at 4 µg/ml in ICC/IF.

      References (1)

      Publishing research using ab222065? Please let us know so that we can cite the reference in this datasheet.

      ab222065 has been referenced in 1 publication.

      • Selinger M  et al. Tick-borne encephalitis virus inhibits rRNA synthesis and host protein production in human cells of neural origin. PLoS Negl Trop Dis 13:e0007745 (2019). PubMed: 31560682

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab222065.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com