Overview

  • Product name

  • Description

    Rabbit polyclonal to POLR1C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human POLR1C aa 125-230.
    Sequence:

    RNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMT WIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAK FSPVAT


    Database link: O15160

  • Positive control

    • WB: HEK-293, K562, NIH/3T3, HepG2 and RAW 264.7 whole cell lysates; Mouse liver and kidney tissue lysates; Rat heart tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 40 kDa (predicted molecular weight: 39,40 kDa).

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
  • Involvement in disease

    Treacher Collins syndrome 3 (TCS3) [MIM:248390]: A form of Treacher Collins syndrome, a disorder of craniofacial development. Treacher Collins syndrome is characterized by a combination of bilateral downward slanting of the palpebral fissures, colobomas of the lower eyelids with a paucity of eyelashes medial to the defect, hypoplasia of the facial bones, cleft palate, malformation of the external ears, atresia of the external auditory canals, and bilateral conductive hearing loss. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 40kDa antibody
    • AA409007 antibody
    • AA959927 antibody
    • Ac2-127 antibody
    • AC40 antibody
    • AL024089 antibody
    • DNA directed RNA polymerase I subunit C antibody
    • DNA directed RNA polymerases I and III 40 kDa polypeptide antibody
    • DNA directed RNA polymerases I and III subunit RPAC1 antibody
    • DNA-directed RNA polymerase I subunit C antibody
    • DNA-directed RNA polymerases I and III 40 kDa polypeptide antibody
    • DNA-directed RNA polymerases I and III subunit RPAC1 antibody
    • MGC105583 antibody
    • MGC161175 antibody
    • POLR1C antibody
    • POLR1E antibody
    • Polymerase (RNA) I polypeptide C, 30kDa antibody
    • RNA polymerase 1 1 antibody
    • RNA polymerase I subunit C antibody
    • RNA polymerases I and III subunit AC1 antibody
    • RP3-337H4.4 antibody
    • RPA39 antibody
    • RPA40 antibody
    • RPA5 antibody
    • RPAC1 antibody
    • RPAC1_HUMAN antibody
    • RPC40 antibody
    • Rpo1 1 antibody
    • TCS3 antibody
    see all

Images

  • All lanes : Anti-POLR1C antibody (ab224621) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 3 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : RAW 264.7 (mouse macrophage cell line transformed with Abelson murine leukemia virus) whole cell lysate
    Lane 6 : Mouse liver tissue lysate
    Lane 7 : Mouse kidney tissue lysate
    Lane 8 : Rat heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 39,40 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

References

ab224621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up