Overview

  • Product name

  • Description

    Rabbit polyclonal to POLR2K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human POLR2K aa 6-53.
    Sequence:

    DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV


    Database link: P53803

  • Positive control

    • SH-SY5Y cells

Properties

Applications

Our Abpromise guarantee covers the use of ab221119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. POLR2K is a common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • ABC10 alpha antibody
    • DNA directed RNA polymerase II polypeptide K antibody
    • DNA directed RNA polymerase II subunit K antibody
    • DNA directed RNA polymerases I II and III 7.0 kda antibody
    • DNA directed RNA polymerases I II and III subunit RPABC4 antibody
    • hRPB7.0 antibody
    • hsRPB10a antibody
    • Polymerase (RNA) II (DNA directed) polypeptide K 7.0kDa antibody
    • Polymerase RNA II DNA directed polypeptide K 7.0kDa antibody
    • RNA polymerase II polypeptide K antibody
    • RNA polymerases I II and III subunit ABC4 antibody
    • RPABC4 antibody
    • RPB10alpha antibody
    • RPB12 antibody
    • RPB7.0 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling POLR2K with ab221119 at 4 µg/ml (green).

References

ab221119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up