Overview

  • Product name

    Anti-POLR2L antibody
  • Description

    Rabbit polyclonal to POLR2L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human POLR2L aa 1-67.
    Sequence:

    MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL AHVDLIEKLLNYAPLEK


    Database link: P62875

Properties

Applications

Our Abpromise guarantee covers the use of ab192366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 8 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.
  • Sequence similarities

    Belongs to the archaeal RpoN/eukaryotic RPB10 RNA polymerase subunit family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • and III subunit ABC5 antibody
    • and III subunit RPABC5 antibody
    • DNA directed RNA polymerase II polypeptide L antibody
    • DNA-directed RNA polymerase III subunit L antibody
    • DNA-directed RNA polymerases I antibody
    • hRPB7.6 antibody
    • hsRPB10b antibody
    • II antibody
    • POLR2L antibody
    • RNA polymerase II 7.6 kDa subunit antibody
    • RNA polymerase II polypeptide L antibody
    • RNA polymerases I antibody
    • RPAB5_HUMAN antibody
    • RPABC5 antibody
    • RPB10 antibody
    • RPB10 homolog antibody
    • RPB10beta antibody
    • RPB7.6 antibody
    see all

References

ab192366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up