Overview

  • Product name

  • Description

    Rabbit polyclonal to POLR3A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human POLR3A aa 392-632.
    Sequence:

    FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMA QELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNEC VCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAA IQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKP VTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC


    Database link: O14802

  • Positive control

    • IHC-P: Human testis and small intestine tissue. ChIP: HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab238596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP Use at an assay dependent concentration.
IHC-P 1/20 - 1/200.

Target

  • Function

    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition (By similarity). Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Tissue specificity

    Expressed in the brain, in the cortex and the white matter (at protein level).
  • Involvement in disease

    Leukodystrophy, hypomyelinating, 7, with or without oligodontia and/or hypogonadotropic hypogonadism
  • Sequence similarities

    Belongs to the RNA polymerase beta' chain family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BC053071 antibody
    • DNA directed RNA polymerase III largest subunit antibody
    • DNA directed RNA polymerase III subunit A antibody
    • DNA-directed RNA polymerase III largest subunit antibody
    • DNA-directed RNA polymerase III subunit A antibody
    • DNA-directed RNA polymerase III subunit RPC1 antibody
    • hRPC155 antibody
    • MGC62420 antibody
    • POLR 3A antibody
    • POLR3A antibody
    • Polymerase (RNA) III (DNA directed) polypeptide A 155kDa antibody
    • Polymerase (RNA) III (DNA directed) polypeptide A antibody
    • RGD1305574 antibody
    • RNA polymerase III 155 kDa subunit antibody
    • RNA polymerase III subunit C1 antibody
    • RNA polymerase III subunit C160 antibody
    • RNA polymerase III subunit RPC155 D antibody
    • RPC1 antibody
    • RPC1_HUMAN antibody
    • RPC155 antibody
    see all

Images

  • HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells (1.6 x 106) were cross-linked with formaldehyde, sonicated and immunoprecipitated with 4 µg of ab238596 or a control normal rabbit IgG. The resulting ChIP DNA was quantified using real-time PCR with primers against the tRNA-Leu Anti-Codon (TAG) promoter.

  • Paraffin-embedded human testis tissue stained for POLR3A with ab238596 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for POLR3A with ab238596 at a 1/100 dilution in immunohistochemical analysis.

References

ab238596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up