Overview

  • Product name
  • Description
    Rabbit polyclonal to POLR3A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human POLR3A aa 607-698.
    Sequence:

    PSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLG SGSKNNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSI


    Database link: O14802

  • Positive control
    • WB: PC3 and MCF7 whole cell lysates. IHC-P: Human cerebral cortex, testis, placenta and liver tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab247007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 156 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition (By similarity). Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.
  • Tissue specificity
    Expressed in the brain, in the cortex and the white matter (at protein level).
  • Involvement in disease
    Leukodystrophy, hypomyelinating, 7, with or without oligodontia and/or hypogonadotropic hypogonadism
  • Sequence similarities
    Belongs to the RNA polymerase beta' chain family.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • BC053071 antibody
    • DNA directed RNA polymerase III largest subunit antibody
    • DNA directed RNA polymerase III subunit A antibody
    • DNA-directed RNA polymerase III largest subunit antibody
    • DNA-directed RNA polymerase III subunit A antibody
    • DNA-directed RNA polymerase III subunit RPC1 antibody
    • hRPC155 antibody
    • MGC62420 antibody
    • POLR 3A antibody
    • POLR3A antibody
    • Polymerase (RNA) III (DNA directed) polypeptide A 155kDa antibody
    • Polymerase (RNA) III (DNA directed) polypeptide A antibody
    • RGD1305574 antibody
    • RNA polymerase III 155 kDa subunit antibody
    • RNA polymerase III subunit C1 antibody
    • RNA polymerase III subunit C160 antibody
    • RNA polymerase III subunit RPC155 D antibody
    • RPC1 antibody
    • RPC1_HUMAN antibody
    • RPC155 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for POLR3A (green) using ab247007 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human liver tissue stained for POLR3A using ab247007 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human placenta tissue stained for POLR3A using ab247007 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for POLR3A using ab247007 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human cerebral cortex tissue stained for POLR3A using ab247007 at 1/200 dilution in immunohistochemical analysis.
  • All lanes : Anti-POLR3A antibody (ab247007) at 0.4 µg/ml

    Lane 1 : PC-3 whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Predicted band size: 156 kDa



    Corresponding POLR3A RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

  • Anti-POLR3A antibody (ab247007) at 0.4 µg/ml + PC-3 whole cell lysate

    Predicted band size: 156 kDa

References

ab247007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up