Overview

  • Product name
    Anti-POLR3GL antibody [OTI2F11]
    See all POLR3GL primary antibodies
  • Description
    Mouse monoclonal [OTI2F11] to POLR3GL
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human POLR3GL aa 1-218. Produced in HEK-293T cells. (NP_115681.1).
    Sequence:

    MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVP LPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPI DNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKTTEDKEETIQK LETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFD NGEDFGGDSDDNMDEAIY


    Database link: Q9BT43

  • Positive control
    • WB: HEK-293T cell lysate transfected with the pCMV6-ENTRY POLR3GL cDNA. IHC-P: Human kidney, pancreas carcinoma, endometrium adenocarcinoma, prostate, prostate carcinoma and lymph node tissue. ICC/IF: pCMV6-ENTRY POLR3GL cDNA transfected COS-7 cells.
  • General notes

    Clone OTI2F11 (formerly 2F11).

Properties

Applications

Our Abpromise guarantee covers the use of ab180359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/4000. Predicted molecular weight: 25 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF 1/100.

Target

Images

  • All lanes : Anti-POLR3GL antibody [OTI2F11] (ab180359) at 1/4000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate, transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate, transfected with pCMV6-ENTRY POLR3GL cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 25 kDa

  • Paraffin-embedded human lymph node tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

  • pCMV6-ENTRY POLR3GL cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for POLR3GL using ab180359 at a 1/100 dilution in ICC/IF.

  • Paraffin-embedded human prostate carcinoma tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

  • Paraffin embedded human prostate tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

  • Paraffin-embedded human pancreas carcinoma tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

  • Paraffin-embedded human kidney tissue stained for POLR3GL with ab180359 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 120°C for 3 minutes.

References

ab180359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up