Anti-Polycystin 2 antibody (ab244346)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Polycystin 2 antibody
See all Polycystin 2 primary antibodies -
Description
Rabbit polyclonal to Polycystin 2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow
-
Immunogen
Recombinant fragment corresponding to Human Polycystin 2 aa 786-927.
Sequence:REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVS YEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLL DGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Database link: Q13563 -
Positive control
- IHC-P: Human kidney tissue. ICC/IF: BJ cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab244346 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis. -
Tissue specificity
Strongly expressed in ovary, fetal and adult kidney, testis, and small intestine. Not detected in peripheral leukocytes. -
Involvement in disease
Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:613095]. ADPKD2 is a disorder characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. It represents approximately 15% of the cases of autosomal dominant polycystic kidney disease. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy. -
Sequence similarities
Belongs to the polycystin family.
Contains 1 EF-hand domain. -
Domain
The C-terminal coiled-coil domain binds calcium and undergoes a calcium-induced conformation change. It is implicated in oligomerization and the interaction with PKD1. -
Cellular localization
Membrane. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 530393 Cow
- Entrez Gene: 5311 Human
- Omim: 173910 Human
- SwissProt: Q4GZT3 Cow
- SwissProt: Q13563 Human
- SwissProt: O35245 Mouse
- Unigene: 181272 Human
- Unigene: 483692 Mouse
see all -
Alternative names
- APKD2 antibody
- Autosomal dominant polycystic kidney disease type II antibody
- Autosomal dominant polycystic kidney disease type II protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Polycystin 2 antibody (ab244346)Formalin-fixed, paraffin-embedded human kidney tissue stained for Polycystin 2 using ab244346 at 1/20 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-Polycystin 2 antibody (ab244346)PFA-fixed, Triton X-100 permeabilized BJ (human fibroblast cell line) cells stained for Polycystin 2 (green) using ab244346 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab244346 has not yet been referenced specifically in any publications.
