Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab224086)

Overview

  • Product name

    Anti-Polymeric immunoglobulin receptor/PIGR antibody
    See all Polymeric immunoglobulin receptor/PIGR primary antibodies
  • Description

    Rabbit polyclonal to Polymeric immunoglobulin receptor/PIGR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Polymeric immunoglobulin receptor/PIGR aa 201-329.
    Sequence:

    LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLR GSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLN PQDKDGSFSVVITGLRKEDAGRYLCGAHS


    Database link: P01833

  • Positive control

    • WB: Human colon tissue lysate. IHC-P: Human colon tissue.
  • General notes

    Previously labelled as PIGR. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 83 kDa.

Target

  • Function

    This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylation is not necessary for Ig binding.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hepatocellular carcinoma associated protein TB6 antibody
    • Hepatocellular carcinoma-associated protein TB6 antibody
    • MGC125361 antibody
    • MGC125362 antibody
    • Phosphatidylinositol glycan, class R antibody
    • PIGR antibody
    • PIGR_HUMAN antibody
    • Poly Ig receptor antibody
    • Poly-Ig receptor antibody
    • Polymeric immunoglobulin receptor antibody
    • Secretory component antibody
    • Transmembrane secretory component antibody
    see all

Images

  • Paraffin embedded human colon tissue stained for Polymeric immunoglobulin receptor/PIGR with ab224086 (1/500 dilution) in immunohistochemical analysis.

  • Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab224086) at 1/100 dilution + Human colon tissue lysate

    Predicted band size: 83 kDa

References

ab224086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up