Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab231675)

Overview

  • Product name

    Anti-Polymeric immunoglobulin receptor/PIGR antibody
    See all Polymeric immunoglobulin receptor/PIGR primary antibodies
  • Description

    Rabbit polyclonal to Polymeric immunoglobulin receptor/PIGR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Bovine Polymeric immunoglobulin receptor/PIGR aa 250-341. (Expressed in E.coli).
    Sequence:

    RSSVTFDCSLGPEVANVPKFLCQKKNGGACNVVINTLGKKAQDFQGRIVS VPKDNGVFSVHITSLRKEDAGRYVCGAQPEGEPQDGWPVQAW


    Database link: P81265

  • Positive control

    • WB: Cow small intestine and stomach lysates; Recombinant cow Polymeric immunoglobulin receptor/PIGR protein.
  • General notes

    Previously labelled as PIGR. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 mg/ml. Predicted molecular weight: 82 kDa.

Target

  • Function

    This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.
  • Sequence similarities

    Contains 5 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylation is not necessary for Ig binding.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hepatocellular carcinoma associated protein TB6 antibody
    • Hepatocellular carcinoma-associated protein TB6 antibody
    • MGC125361 antibody
    • MGC125362 antibody
    • Phosphatidylinositol glycan, class R antibody
    • PIGR antibody
    • PIGR_HUMAN antibody
    • Poly Ig receptor antibody
    • Poly-Ig receptor antibody
    • Polymeric immunoglobulin receptor antibody
    • Secretory component antibody
    • Transmembrane secretory component antibody
    see all

Images

  • All lanes : Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab231675) at 2 µg/ml

    Lane 1 : Bovine stomach tissue
    Lane 2 : Bovine intestine tissue

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 82 kDa

  • Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab231675) at 2 µg/ml + Cow stomach lysate

    Predicted band size: 82 kDa

  • Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab231675) at 2 µg/ml + Cow small intestine lysate

    Predicted band size: 82 kDa

  • Anti-Polymeric immunoglobulin receptor/PIGR antibody (ab231675) at 2 µg/ml + Recombinant cow PIGR protein

    Predicted band size: 82 kDa

References

ab231675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up