Overview

  • Product name

  • Description

    Rabbit polyclonal to POM121
  • Host species

    Rabbit
  • Specificity

    ab190015 detects endogenous levels of total POM121 protein.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human POM121 aa 1197-1246. The exact sequence is proprietary.
    Sequence:

    SSLSFGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHT


    Database link: Q96HA1

  • Positive control

    • Human skin tissue and extracts from K562 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS

    PBS is without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab190015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB 1/500 - 1/1000. Predicted molecular weight: 127 kDa.

Target

  • Function

    Essential component of the nuclear pore complex (NPC). The repeat-containing domain may be involved in anchoring components of the pore complex to the pore membrane. When overexpressed in cells induces the formation of cytoplasmic annulate lamellae (AL).
  • Sequence similarities

    Belongs to the POM121 family.
  • Domain

    Contains F-X-F-G repeats.
  • Cellular localization

    Nucleus > nuclear pore complex. Nucleus membrane. Endoplasmic reticulum membrane. Stably associated with the NPC throughout interphase and the endoplasmic reticulum during metaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp586G1822 antibody
    • DKFZp586P2220 antibody
    • FLJ41820 antibody
    • KIAA0618 antibody
    • MGC3792 antibody
    • Nuclear envelope pore membrane protein POM 121 antibody
    • Nuclear envelope pore membrane protein POM 121A antibody
    • Nuclear pore membrane protein 121 kDa antibody
    • Nucleoporin Nup121 antibody
    • NUP121 antibody
    • P121A_HUMAN antibody
    • P145 antibody
    • Pom121 antibody
    • POM121 membrane glycoprotein antibody
    • POM121A antibody
    • Pore membrane protein of 121 kDa antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue labeling POM121 with ab190015 at 10 µg/ml.

  • All lanes : Anti-POM121 antibody (ab190015) at 1/500 dilution

    Lane 1 : Extract from K562 cells
    Lane 2 : Extract from K562 cells with synthesized peptide

    Predicted band size: 127 kDa

References

This product has been referenced in:

  • Friedrich T  et al. Subcellular compartmentalization of docking protein-1 contributes to progression in colorectal cancer. EBioMedicine 8:159-72 (2016). Read more (PubMed: 27428427) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up